PDB entry 2z4q

View 2z4q on RCSB PDB site
Description: Crystal structure of a murine antibody FAB 528
Class: immune system
Keywords: immune system
Deposited on 2007-06-22, released 2007-10-30
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-22, with a file datestamp of 2008-04-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: anti egfr antibody fab, light chain
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • PDB 2Z4Q (0-218)
• Chain 'B':
  Compound: anti egfr antibody fab, heavy chain
  Species: Mus musculus
  Database cross-references and differences (RAF-indexed):
  • PDB 2Z4Q (0-217)
  Domains in SCOP 1.75: d2z4qb1
• Heterogens: CD, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2z4qB (B:)
  qvqlqqsgsemarpgasvklpckasgdtftsywmhwvkqrhghgpewigniypgsggtny
  aekfknkvtltvdrssrtvymhlsrltsedsavyyctrsggpyffdywgqgtsltvssak
  ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
  tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr