PDB entry 2z4q

View 2z4q on RCSB PDB site
Description: Crystal structure of a murine antibody FAB 528
Class: immune system
Keywords: immune system
Deposited on 2007-06-22, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti egfr antibody fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z4Q (0-218)
    Domains in SCOPe 2.07: d2z4qa1, d2z4qa2
  • Chain 'B':
    Compound: anti egfr antibody fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Z4Q (0-217)
    Domains in SCOPe 2.07: d2z4qb1, d2z4qb2
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z4qA (A:)
    dilmtqtplslpvslgdqasiscrssqnivhnngitylewylqrpgqspklliykvsdrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshipptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z4qB (B:)
    qvqlqqsgsemarpgasvklpckasgdtftsywmhwvkqrhghgpewigniypgsggtny
    aekfknkvtltvdrssrtvymhlsrltsedsavyyctrsggpyffdywgqgtsltvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr