PDB entry 2z3r

View 2z3r on RCSB PDB site
Description: Crystal structure of the IL-15/IL-15Ra complex
Class: cytokine/cytokine receptor
Keywords: Protein-Protein complex, CYTOKINE-CYTOKINE RECEPTOR COMPLEX
Deposited on 2007-06-05, released 2007-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3ra2, d2z3ra3
  • Chain 'B':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d2z3rb2, d2z3rb3
  • Chain 'C':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3rc2, d2z3rc3
  • Chain 'D':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d2z3rd2, d2z3rd3
  • Chain 'E':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3re2, d2z3re3
  • Chain 'F':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d2z3rf2, d2z3rf3
  • Chain 'G':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3rg2, d2z3rg3
  • Chain 'H':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3rh2, d2z3rh3
  • Chain 'I':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3ri2, d2z3ri3
  • Chain 'J':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3rj2, d2z3rj3
  • Chain 'K':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3rk2, d2z3rk3
  • Chain 'L':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d2z3rl2, d2z3rl3
  • Chain 'M':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-118)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3rm2, d2z3rm3
  • Chain 'N':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d2z3rn2, d2z3rn3
  • Chain 'O':
    Compound: Interleukin-15
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40933 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d2z3ro2, d2z3ro3
  • Chain 'P':
    Compound: Interleukin-15 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL-15RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13261 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d2z3rp2, d2z3rp3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z3rA (A:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rA (A:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslsstesgckeceeleeknikeflqsfvhivqmfin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z3rB (B:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rB (B:)
    sitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttp
    slkcirdpalvhqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2z3rC (C:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rC (C:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssvtesgckeceeleeknikeflqsfvhivqmfints
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2z3rD (D:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rD (D:)
    maisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahw
    ttpslkcirdpalvhq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3rE (E:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2z3rF (F:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rF (F:)
    sitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttp
    slkcirdpalvhq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z3rG (G:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2z3rH (H:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rH (H:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2z3rI (I:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rI (I:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssvtesgckeceeleeknikeflqsfvhivqmfints
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2z3rJ (J:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rJ (J:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2z3rK (K:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rK (K:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssvtesgckeceeleeknikeflqsfvhivqmfints
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2z3rL (L:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rL (L:)
    isitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwtt
    pslkcirdpalvhqr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2z3rM (M:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rM (M:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssvtesgckeceeleeknikeflqsfvhivqmfints
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2z3rN (N:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rN (N:)
    maisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahw
    ttpslkcirdpalvhq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2z3rO (O:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfints
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rO (O:)
    amaisnwvnvisdlkkiedliqsmhidatlytesdvhpsckvtamkcfllelqvislesg
    dasihdtvenliilannslssngnvtesgckeceeleeknikeflqsfvhivqmfint
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2z3rP (P:)
    amaisitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvah
    wttpslkcirdpalvhqrpappstvttagvtpqpeslspsgkepaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z3rP (P:)
    sitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttp
    slkcirdpalvh