PDB entry 2z3e

View 2z3e on RCSB PDB site
Description: A Mechanistic view of Enzyme Inhibition and Peptide Hydrolysis in the Active Site of the SARS-CoV 3C-Like peptidase
Class: hydrolase inhibitor, viral protein
Keywords: SARS, 3C-like peptidase, 3CL, main proteinase, chymotrypsin, viral cysteine protease, HYDROLASE INHIBITOR, VIRAL PROTEIN
Deposited on 2007-06-04, released 2007-07-03
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-06, with a file datestamp of 2008-05-02.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicase polyprotein 1ab (pp1ab)
    Species: SARS coronavirus
    Gene: rep
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2z3ea1
  • Chain 'I':
    Compound: (val)(thr)(leu)
    Species: synthetic, synthetic
  • Heterogens: ACE, MBN, KCQ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2z3eA (A:)
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

  • Chain 'I':
    No sequence available.