PDB entry 2z38

View 2z38 on RCSB PDB site
Description: Crystal structure of chloride bound Brassica juncea chitinase catalytic module (Bjchi3)
Class: hydrolase
Keywords: chitinase, endochitinase, family 19, conformational changes, HYDROLASE
Deposited on 2007-06-02, released 2007-06-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.157
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: Brassica juncea [TaxId:3707]
    Gene: Bjchi1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SQF7 (2-246)
      • cloning artifact (0-1)
    Domains in SCOPe 2.02: d2z38a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2z38A (A:)
    efgdlsgiisrdqfykmlkhmndndchavgfftydafitaaksfpsfgntgdlamrkkei
    aaffgqtshettggwsgapdgantwgycykeeidksdphcdsnnlewpcapgkfyygrgp
    mmlswnynygpcgrdlglellknpdvassdpviafktaiwfwmtpqapkpschdvitdqw
    epsaadisagrlpgygvitniingglecagrdvakvqdrisfytrycgmfgvdpgsnidc
    dnqrpfn