PDB entry 2z1s

View 2z1s on RCSB PDB site
Description: Beta-glucosidase B from paenibacillus polymyxa complexed with cellotetraose
Class: hydrolase
Keywords: Beta-glucosidase, glycosyl hydrolase family 1, substrate complex
Deposited on 2007-05-12, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase B
    Species: Paenibacillus polymyxa [TaxId:1406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22505 (Start-453)
      • engineered (381-382)
    Domains in SCOPe 2.06: d2z1sa_
  • Heterogens: CTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z1sA (A:)
    mhhhhhhsentfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgd
    vacdhfhhfkedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielagl
    ipmltlyhwdlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasil
    gygtgehapghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserp
    edvaaairrdgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflg
    inyytrsiirstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpili
    tengaamrdelvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgy
    skrfgivhinyetqertpkqsalwfkqmmakngf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z1sA (A:)
    ntfifpatfmwgtstssyqieggtdeggrtpsiwdtfcqipgkviggdcgdvacdhfhhf
    kedvqlmkqlgflhyrfsvawprimpaagiineegllfyehlldeielaglipmltlyhw
    dlpqwiedeggwtqretiqhfktyasvimdrfgerinwwntinepycasilgygtgehap
    ghenwreaftaahhilmchgiasnlhkekgltgkigitlnmehvdaaserpedvaaairr
    dgfinrwfaeplfngkypedmvewygtylngldfvqpgdmeliqqpgdflginyytrsii
    rstndasllqveqvhmeepvtdmgweihpesfyklltriekdfskglpilitengaamrd
    elvngqiedtgrqryieehlkachrfieeggqlkgyfvwsfldnfewawgyskrfgivhi
    nyetqertpkqsalwfkqmmakngf