PDB entry 2z0o

View 2z0o on RCSB PDB site
Description: Crystal structure of APPL1-BAR-PH domain
Class: signaling protein
Keywords: helix bundle, Cell cycle, Coiled coil, Endosome, Membrane, Nucleus, Phosphorylation, SIGNALING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2008-05-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DCC-interacting protein 13-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2z0oa1, d2z0oa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z0oA (A:)
    gsmpgidklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaat
    hltskllkeyekqrfplggddevmsstlqqfskvidelsschavlstqladammfpitqf
    kerdlkeiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtm
    mhyfcalntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrr
    emdsdietmqqtiedlevasdplyvpdpdptkfpvnrnltrkagylnarnktglvsstwd
    rqfyftqggnlmsqargdvagglamdidncsvmavdcedrrycfqitsfdgkkssilqae
    skkdheewictinniskqiylsenpee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0oA (A:)
    mpgidklpieetledspqtrsllgvfeedataisnymnqlyqamhriydaqnelsaathl
    tskllkeyekqrfpldevmsstlqqfskvidelsschavlstqladammfpitqfkerdl
    keiltlkevfqiasndhdaainrysrlskkrendkvkyevtedvytsrkkqhqtmmhyfc
    alntlqykkkiallepllgymqaqisffkmgsenlneqleeflanigtsvqnvrremdsd
    ietmqqtiedlevasdplyvpdpdptkfpvnrnltrkagylnardrqfyftqggnlmsqa
    rgdvagglamdidncsvmavdcedrrycfqitsssilqaeskkdheewictinn