PDB entry 2z0m

View 2z0m on RCSB PDB site
Description: Crystal structure of hypothetical ATP-dependent RNA helicase from Sulfolobus tokodaii
Class: RNA binding protein
Keywords: helicase, ATP-binding, Hydrolase, Nucleotide-binding, RNA BINDING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-07, released 2007-11-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 337aa long hypothetical ATP-dependent RNA helicase deaD
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2z0ma1, d2z0ma2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z0mA (A:)
    mnekieqairemgfknftevqsktiplmlqgknvvvraktgsgktaayaipilelgmksl
    vvtptreltrqvashirdigrymdtkvaevyggmpykaqinrvrnadivvatpgrlldlw
    skgvidlssfeiviideadlmfemgfiddikiilaqtsnrkitglfsatipeeirkvvkd
    fitnyeeieaciglanvehkfvhvkddwrskvqalrenkdkgvivfvrtrnrvaklvrlf
    dnaielrgdlpqsvrnrnidafregeydmlittdvasrgldiplvekvinfdapqdlrty
    ihrigrtgrmgrkgeaitfilneywlekevkkvsqka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0mA (A:)
    mnekieqairemgfknftevqsktiplmlqgknvvvraktgsgktaayaipilelgmksl
    vvtptreltrqvashirdigrymdtkvaevyggmpykaqinrvrnadivvatpgrlldlw
    skgvidlssfeiviideadlmfemgfiddikiilaqtsnrkitglfsatipeeirkvvkd
    fitnyeeieaciglanvehkfvhvkddwrskvqalrenkdkgvivfvrtrnrvaklvrlf
    dnaielrgdlpqsvrnrnidafregeydmlittdvasrgldiplvekvinfdapqdlrty
    ihrigrtgrmgrkgeaitfilneywlekevk