PDB entry 2z0d

View 2z0d on RCSB PDB site
Description: The crystal structure of human Atg4B- LC3(1-120) complex
Class: hydrolase/structural protein
Keywords: papain-like fold, ubiquitin fold, HYDROLASE/STRUCTURAL PROTEIN COMPLEX
Deposited on 2007-05-07, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine protease ATG4B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y4P1 (Start-356)
      • engineered (282)
    Domains in SCOPe 2.07: d2z0da1
  • Chain 'B':
    Compound: Microtubule-associated proteins 1A/1B light chain 3B
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2z0db_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2z0dA (A:)
    gphmdaatltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrkn
    fpaiggtgptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafid
    rkdsyysihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvme
    eirrlcrtsvpcagatafpadsdrhcngfpagaevtnrpspwrplvlliplrlgltdine
    ayvetlkhcfmmpqslgviggkpnsahyfigyvgeeliyldpattqpaveptdgcfipde
    sfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkklsllggalpmfelveq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0dA (A:)
    tltydtlrfaefedfpetsepvwilgrkysiftekdeilsdvasrlwftyrknfpaiggt
    gptsdtgwgcmlrcgqmifaqalvcrhlgrdwrwtqrkrqpdsyfsvlnafidrkdsyys
    ihqiaqmgvgegksigqwygpntvaqvlkklavfdtwsslavhiamdntvvmeeirrlcr
    tspwrplvlliplrlgltdineayvetlkhcfmmpqslgviggkpnsahyfigyvgeeli
    yldpattqpavepipdesfhcqhppcrmsiaeldpsiavgffckteddfndwcqqvkkla
    lpmfelveq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2z0dB (B:)
    gplgsmpsektfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvp
    dhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyas
    qetfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2z0dB (B:)
    ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
    kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqetfg