PDB entry 2yzq

View 2yzq on RCSB PDB site
Description: Crystal structure of uncharacterized conserved protein from Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: sheet/helix/sheet/sheet/helix, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-06, released 2007-11-06
The last revision prior to the SCOP 1.75 freeze date was dated 2007-11-06, with a file datestamp of 2007-11-02.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.225
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein PH1780
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59416 (1-End)
      • initiating methionine (0)
    Domains in SCOP 1.75: d2yzqa1, d2yzqa2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yzqA (A:)
    mrvktimtqnpvtitlpatrnyalelfkkykvrsfpvvnkegklvgiisvkrilvnpdee
    qlamlvkrdvpvvkendtlkkaaklmleydyrrvvvvdskgkpvgiltvgdiirryfaks
    ekykgveiepyyqryvsivwegtplkaalkalllsnsmalpvvdsegnlvgivdetdllr
    dseivrimkstelaasseeewileshptllfekfelqlpnkpvaeimtrdvivatphmtv
    hevalkmakysieqlpvirgegdliglirdfdllkvlvkska
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yzqA (A:)
    mrvktimtqnpvtitlpatvrsfpvvnkegklvgiisvkrimlvkrdvpvvkendtlkka
    aklmleydyrrvvvvdskgkpvgiltvgdiirryfaksekykgveiepyyqryvsivweg
    tplkaalkalllsnsmalpvvdsegnlvgivdetdllrdseivrpnkpvaeimtrdviva
    tphmtvhevalkmakysieqlpvirgegdliglirdfdllkvlv