PDB entry 2yzm

View 2yzm on RCSB PDB site
Description: Structure of D-Alanine:D-Alanine Ligase with substrate from Thermus thermophilus HB8
Class: Ligase
Keywords: D-Alanine:D-Alanine Ligase, Cell shape, Peptidoglycan synthesis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Ligase
Deposited on 2007-05-06, released 2007-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yzma1, d2yzma2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yzmb1, d2yzmb2
  • Chain 'C':
    Compound: d-alanine--d-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2yzmc1, d2yzmc2
  • Heterogens: DAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yzmA (A:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yzmB (B:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yzmB (B:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapftpgraellipapldpgtq
    etvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvayp
    ellrrlvelalt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yzmC (C:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yzmC (C:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapraellipapldpgtqetvq
    elalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvaypellr
    rlvelalt