PDB entry 2yzg

View 2yzg on RCSB PDB site
Description: Crystal structure of D-ALA:D-ALA Ligase from Thermus thermophilus HB8
Class: ligase
Keywords: D-alanine:D-alanine ligase, Cell shape, Peptidoglycan synthesis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-05-05, released 2007-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yzga1, d2yzga2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yzgb1, d2yzgb2
  • Chain 'C':
    Compound: d-alanine--d-alanine ligase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2yzgc1, d2yzgc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yzgA (A:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yzgB (B:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yzgB (B:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfpgraellipapldpgtqe
    tvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvaype
    llrrlvelalt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yzgC (C:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgraellipa
    pldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfe
    aggvaypellrrlvelalt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yzgC (C:)
    mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
    gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcmdkdlsk
    rvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdleaalalaf
    rydekavvekalspvrelevgvlgnvfgeaspvgevryeapgraellipapldpgtqetv
    qelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvaypell
    rrlvelalt