PDB entry 2yya

View 2yya on RCSB PDB site
Description: Crystal structure of GAR synthetase from Aquifex aeolicus
Class: ligase
Keywords: Glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding, Purine nucleotide biosynthetic pathway, LIGASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-27, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yyaa1, d2yyaa2, d2yyaa3
  • Chain 'B':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yyab1, d2yyab2, d2yyab3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yyaA (A:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    ylse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yyaA (A:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    yls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yyaB (B:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    ylse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yyaB (B:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    yls