PDB entry 2yy1

View 2yy1 on RCSB PDB site
Description: Crystal sturcture of N-terminal domain of human galectin-9 containing L-acetyllactosamine
Class: sugar binding protein
Keywords: suger binding, galectin, human, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2007-04-27, released 2008-04-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.211
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Galectin-9
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00182 (Start-153)
  Domains in SCOPe 2.03: d2yy1a_
• Heterogens: NLC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2yy1A (A:)
  gssgssgmafsgsqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgf
  sgndiafhfnprfedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvm
  vngilfvqyfhrvpfhrvdtisvngsvqlsyisfsgpssg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2yy1A (A:)
  qapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnprf
  edggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhrv
  pfhrvdtisvngsvqlsyisf