PDB entry 2yx7

View 2yx7 on RCSB PDB site
Description: Crystals structure of T132A mutant of St1022 from sulfolobus tokodaii 7
Class: transcription
Keywords: transcriptional regulator, st1022, Lrp/AsnC family, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-24, released 2008-04-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 150aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:111955]
    Gene: ST1022
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972W6 (0-149)
      • engineered (131)
    Domains in SCOPe 2.04: d2yx7a1, d2yx7a2
  • Heterogens: MG, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yx7A (A:)
    mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
    ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
    ervmsipeverastqvvvkiikespnivif