PDB entry 2yx7

View 2yx7 on RCSB PDB site
Description: Crystals structure of T132A mutant of St1022 from sulfolobus tokodaii 7
Class: transcription
Keywords: transcriptional regulator, st1022, Lrp/AsnC family, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2007-04-24, released 2008-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 150aa long hypothetical transcriptional regulator
  Species: Sulfolobus tokodaii [TaxId:111955]
  Gene: ST1022
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q972W6 (0-149)
    • engineered (131)
  Domains in SCOPe 2.08: d2yx7a1, d2yx7a2
• Heterogens: MG, GLN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yx7A (A:)
  mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
  ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
  ervmsipeverastqvvvkiikespnivif