PDB entry 2yx6

View 2yx6 on RCSB PDB site
Description: Crystal structure of PH0822
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-24, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PH0822
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yx6a_
  • Chain 'B':
    Compound: Hypothetical protein PH0822
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yx6b_
  • Chain 'C':
    Compound: Hypothetical protein PH0822
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yx6c_
  • Chain 'D':
    Compound: Hypothetical protein PH0822
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yx6d_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yx6A (A:)
    mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik
    dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkekieke
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yx6A (A:)
    mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfgdlpnfikdhgak
    ivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yx6B (B:)
    mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik
    dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkekieke
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yx6B (B:)
    mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfgdlpnfikdhgak
    ivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkek
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yx6C (C:)
    mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik
    dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkekieke
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yx6C (C:)
    mrvaipaeddiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgdlpnfikdhga
    kivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yx6D (D:)
    mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfeehgpgdlpnfik
    dhgakivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwkekieke
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yx6D (D:)
    mrvaipaeddrgiksnvskhfgrsryfvfvdiegedvknvevvevpfgpgdlpnfikdhg
    akivltygigrraieyfnslgisvvtgvygrisdvikafiggklkidydwk