PDB entry 2yx4

View 2yx4 on RCSB PDB site
Description: Crystal Structure of T134A of ST1022 from Sulfolobus tokodaii
Class: transcription regulator
Keywords: Transcriptional regulator, Lrp/AsnC family binding, ST1022, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION REGULATOR
Deposited on 2007-04-24, released 2008-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.251
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 150aa long hypothetical transcriptional regulator
  Species: Sulfolobus tokodaii [TaxId:111955]
  Gene: ST1022
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q972W6 (0-149)
    • engineered (133)
  Domains in SCOPe 2.06: d2yx4a1, d2yx4a2
• Heterogens: MG, GLN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yx4A (A:)
  mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
  ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
  ervmsipevertsaqvvvkiikespnivif