PDB entry 2ywk
View 2ywk on RCSB PDB site
Description: Crystal structure of RRM-domain derived from human putative RNA-binding protein 11
Class: RNA binding protein
Keywords: RRM-domain, RNA-binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on
2007-04-20, released
2008-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-11, with a file datestamp of
2017-10-06.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Putative RNA-binding protein 11
Species: Homo sapiens [TaxId:9606]
Gene: RBM11
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2ywka1, d2ywka2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2ywkA (A:)
gssgssgmfpaqeeadrtvfvgnlearvreeilyelflqagpltkvtickdregkpksfg
fvcfkhpesvsyaiallngirlygrpinvsgpssg
Sequence, based on observed residues (ATOM records): (download)
>2ywkA (A:)
qeeadrtvfvgnlearvreeilyelflqagpltkvtickdregkpksfgfvcfkhpesvs
yaiallngirlygrpinvsgpssg