PDB entry 2yw7

View 2yw7 on RCSB PDB site
Description: Crystal structure of C-terminal deletion mutant of Mycobacterium smegmatis Dps
Class: DNA binding protein
Keywords: DNA-BINDING PROTEIN, Quarternary assebmly, DNA BINDING PROTEIN
Deposited on 2007-04-19, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.224
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7a1
  • Chain 'B':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7b1
  • Chain 'C':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7c1
  • Chain 'D':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7d1
  • Chain 'E':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7e1
  • Chain 'F':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7f1
  • Chain 'G':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7g1
  • Chain 'H':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7h1
  • Chain 'I':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7i1
  • Chain 'J':
    Compound: starvation-induced DNA protecting protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw7j1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yw7A (A:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7A (A:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrahl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yw7B (B:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7B (B:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yw7C (C:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7C (C:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrahle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yw7D (D:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7D (D:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrah
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yw7E (E:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7E (E:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrah
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yw7F (F:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7F (F:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrahl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2yw7G (G:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7G (G:)
    kasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaeri
    atlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledldl
    vsqdlliahagelekfqwfvrahl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yw7H (H:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7H (H:)
    kkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaer
    iatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledld
    lvsqdlliahagelekfqwfvrahle
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2yw7I (I:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7I (I:)
    kkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaer
    iatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledld
    lvsqdlliahagelekfqwfvrahl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2yw7J (J:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw7J (J:)
    kkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaer
    iatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledld
    lvsqdlliahagelekfqwfvrahle