PDB entry 2yw6

View 2yw6 on RCSB PDB site
Description: Structural studies of N terminal deletion mutant of Dps from Mycobacterium smegmatis
Class: oxidoreductase
Keywords: DNA-BINDING PROTEIN, Quarternary assembly, Ferroxidation, OXIDOREDUCTASE
Deposited on 2007-04-19, released 2007-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA protection during starvation protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: dps
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw6a_
  • Chain 'B':
    Compound: DNA protection during starvation protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: dps
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw6b_
  • Chain 'C':
    Compound: DNA protection during starvation protein
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: dps
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw6c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yw6A (A:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw6A (A:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrahles
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yw6B (B:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw6B (B:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrahlesag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yw6C (C:)
    mtsftipglsdkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvel
    vrgyadevaeriatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedt
    rksiekledldlvsqdlliahagelekfqwfvrahlesaggqlthegqstekgaadkarr
    ksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw6C (C:)
    dkkasdvadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevae
    riatlgkspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledl
    dlvsqdlliahagelekfqwfvrahlesag