PDB entry 2yw2

View 2yw2 on RCSB PDB site
Description: Crystal structure of GAR synthetase from Aquifex aeolicus in complex with ATP
Class: ligase
Keywords: Glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding, Purine nucleotide biosynthetic pathway, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-04-19, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw2a1, d2yw2a2, d2yw2a3
  • Chain 'B':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yw2b1, d2yw2b2, d2yw2b3
  • Heterogens: PO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yw2A (A:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    ylse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw2A (A:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    yls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yw2B (B:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    ylse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yw2B (B:)
    mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
    egvdftivgpeaplvegivdefekrglkifgpnkeaaklegskafaktfmkkygiptary
    evftdfekakeyvekvgapivvkadglaagkgavvcetvekaietldrflnkkifgksse
    rvvieeflegeeasyivmingdryvplptsqdhkrlldedkgpntggmgaysptpvinee
    vekrireeivervikglkeegiyyrgflyaglmitkegpkvlefnvrlgdpeaqpilmrv
    kndfletllnfyegkdvhikederyaldvvlasrgypekpetgkiihgldylksmedvvv
    fhagtkkegnftvtsggrvlnvcaygktlkeakerayeairyvcfegmhyrkdigdkafk
    yls