PDB entry 2yvu

View 2yvu on RCSB PDB site
Description: Crystal structure of APE1195
Class: transferase
Keywords: TRANSFERASE, KINASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-15, released 2007-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable adenylyl-sulfate kinase
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: cysC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yvua_
  • Chain 'B':
    Compound: Probable adenylyl-sulfate kinase
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: cysC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yvub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yvuA (A:)
    mqalttykciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsega
    gftreerlrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvk
    asleevirrdpkglykkalkgelenftgitdpyeppenpqlvldtesntiehnvsylysl
    vkavie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yvuA (A:)
    kciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreer
    lrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevi
    rrdpkglykkalkgelenftgitdpyeppenpqlvldtesntiehnvsylyslvkavie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yvuB (B:)
    mqalttykciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsega
    gftreerlrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvk
    asleevirrdpkglykkalkgelenftgitdpyeppenpqlvldtesntiehnvsylysl
    vkavie
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yvuB (B:)
    kciekgivvwltglpgsgkttiatrladllqkegyrvevldgdwarttvsegagftreer
    lrhlkriawiarllarngvivicsfvspykqarnmvrriveeegipfleiyvkasleevi
    rrdpkglykkalkgetdpyeppenpqlvldtesntiehnvsylyslvkavie