PDB entry 2yvj

View 2yvj on RCSB PDB site
Description: Crystal structure of the ferredoxin-ferredoxin reductase (BPHA3-BPHA4)complex
Class: oxidoreductase/electron transport
Keywords: electron transfer, ferredoxin, ferredoxin reductase, OXIDOREDUCTASE/ELECTRON TRANSPORT COMPLEX
Deposited on 2007-04-12, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin reductase
    Species: Pseudomonas sp. [TaxId:306]
    Gene: bphA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yvja1, d2yvja2, d2yvja3, d2yvja4
  • Chain 'B':
    Compound: Biphenyl dioxygenase ferredoxin subunit
    Species: Pseudomonas sp. [TaxId:306]
    Gene: bphA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yvjb_
  • Chain 'P':
    Compound: Ferredoxin reductase
    Species: Pseudomonas sp. [TaxId:306]
    Gene: bphA4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yvjp1, d2yvjp2, d2yvjp3, d2yvjp4
  • Heterogens: FES, FAD, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yvjA (A:)
    msqealkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgd
    aekirldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlq
    gatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprl
    msraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlan
    dalaraaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgia
    varhlvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkg
    rivgatcvnnardfaplrrllavgakpdraaladpatdlrklaaavaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yvjA (A:)
    alkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaeki
    rldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlqgatm
    pvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprlmsra
    apatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlandala
    raaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarh
    lvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivg
    atcvnnardfaplrrllavgakpdraaladpatdlrklaaav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yvjB (B:)
    mtftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdv
    vecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yvjB (B:)
    tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
    ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraal
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2yvjP (P:)
    msqealkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgd
    aekirldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlq
    gatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprl
    msraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlan
    dalaraaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgia
    varhlvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkg
    rivgatcvnnardfaplrrllavgakpdraaladpatdlrklaaavaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yvjP (P:)
    lkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaekir
    ldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlqgatmp
    vhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprlmsraa
    patladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlandalar
    aaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarhl
    vdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivga
    tcvnnardfaplrrllavgakpdraaladpatdlrklaaav