PDB entry 2yv2

View 2yv2 on RCSB PDB site
Description: Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Aeropyrum pernix K1
Class: ligase
Keywords: CoA-binding domain, ligase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: succinyl-coa synthetase alpha chain
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: sucD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yv2a1, d2yv2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yv2A (A:)
    mgwcvmavlvdsetrvlvqgitgregsfhakamleygtkvvagvtpgkggsevhgvpvyd
    svkealaehpeintsivfvpapfapdavyeavdagirlvvvitegipvhdtmrfvnyarq
    kgatiigpncpgaitpgqakvgimpghifkeggvavvsrsgtltyeisymltrqgigqst
    vigiggdpivglsftealklfqedpqtealvligeiggdmeeraaemikkgeftkpviay
    iagrtappekrmghagaiimmgtgtyegkvkalreagvevaetpfevpelvrkalrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yv2A (A:)
    lvdsetrvlvqgitgregsfhakamleygtkvvagvtpgkggsevhgvpvydsvkealae
    hpeintsivfvpapfapdavyeavdagirlvvvitegipvhdtmrfvnyarqkgatiigp
    ncpgaitpgqakvgimpghifkeggvavvsrsgtltyeisymltrqgigqstvigiggdp
    ivglsftealklfqedpqtealvligeiggdmeeraaemikkgeftkpviayiagrtgty
    egkvkalreagvevaetpfevpelvrkal