PDB entry 2yv1

View 2yv1 on RCSB PDB site
Description: Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
Class: ligase
Keywords: CoA-binding domain, ligase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-06, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA ligase [ADP-forming] subunit alpha
    Species: METHANOCALDOCOCCUS JANNASCHII [TaxId:243232]
    Gene: sucD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2yv1a1, d2yv1a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yv1A (A:)
    mvlrdkmilldentkaivqgitgrqgsfhtkkmlecgtkivggvtpgkggqnvhgvpvfd
    tvkeavketdanasvifvpapfakdavfeaidagielivvitehipvhdtmefvnyaedv
    gvkiigpntpgiaspkvgklgiipmevlkegsvgmvsrsgtltyeiahqikkagfgvstc
    vgiggdpivglrykevldlfekddeteaivmigeigggaeeeaakfiekmkkpvigyiag
    qsapegkrmghagaivekgkgtaeskmkaleeagayvaknisdipkllagilgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yv1A (A:)
    milldentkaivqgitgrqgsfhtkkmlecgtkivggvtpgkggqnvhgvpvfdtvkeav
    ketdanasvifvpapfakdavfeaidagielivvitehipvhdtmefvnyaedvgvkiig
    pntpgiaspkvgklgiipmevlkegsvgmvsrsgtltyeiahqikkagfgvstcvgiggd
    pivglrykevldlfekddeteaivmigeigggaeeeaakfiekmkkpvigyiagqgtaes
    kmkaleeagayvaknisdipkllagilg