PDB entry 2yuz

View 2yuz on RCSB PDB site
Description: Solution Structure of 4th Immunoglobulin Domain of Slow Type Myosin-Binding Protein C
Class: immune system
Keywords: immunoglobulin domain, slow-type Myosin-binding protein C, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM
Deposited on 2007-04-06, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, slow-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MYBPC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00872 (7-93)
      • expression tag (0-6)
      • see remark 999 (55)
      • expression tag (94-99)
    Domains in SCOPe 2.06: d2yuza1, d2yuza2, d2yuza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yuzA (A:)
gssgssglkiltpltdqtvnlgkeiclkceisenipgkwtknglpvqesdrlkvvqkgri
hklvianaltedegdyvfapdaynvtlpakvhvisgpssg