PDB entry 2ysx

View 2ysx on RCSB PDB site
Description: Solution structure of the human SHIP SH2 domain
Class: signaling protein
Keywords: SH2 domain, Phosphotyrosine binding domain, Protein Tyrosine Kinase, Signal Transduction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-04-04, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Signaling inositol polyphosphate phosphatase SHIP II
  Species: Homo sapiens [TaxId:9606]
  Gene: SHIP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UE80 (7-118)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d2ysxa1, d2ysxa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ysxA (A:)
  gssgssgmvpcwnhgnitrskaeellsrtgkdgsflvrasesisrayalcvlyrncvyty
  rilpneddkftvqasegvsmrfftkldqliefykkenmglvthlqypvpleeedtgddp