PDB entry 2ysq

View 2ysq on RCSB PDB site
Description: Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9
Class: signaling protein
Keywords: SH3 domain; Cdc42 guanine nucleotide exchange factor (GEF) 9, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-04-03, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 9
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF9, KIAA0424
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43307 (6-74)
      • expression tag (0-5)
      • expression tag (75-80)
    Domains in SCOPe 2.06: d2ysqa1, d2ysqa2, d2ysqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ysqA (A:)
    gssgssgdsivsaeavwdhvtmanrelafkagdvikvldasnkdwwwgqiddeegwfpas
    fvrlwvnqedeveegsgpssg