PDB entry 2yrw

View 2yrw on RCSB PDB site
Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
Class: ligase
Keywords: Glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding, Purine nucleotide biosynthetic pathway, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2007-04-03, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylglycinamide synthetase
    Species: Geobacillus kaustophilus [TaxId:1462]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5L3C7 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.06: d2yrwa1, d2yrwa2, d2yrwa3, d2yrwa4
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yrwA (A:)
    mgsshhhhhhssgenlyfqshmnvlvigrggrehaiawkaaqsplvgklyvapgnpgiad
    vaelvhideldiealvqfakqqaidltivgpeaplasgivdrfmaeglrifgpsqraali
    egskafakelmkkygiptadhaaftsyeeakayieqkgapivikadglaagkgvtvaqtv
    eealaaakaalvdgqfgtagsqvvieeylegeefsfmafvngekvyplaiaqdhkraydg
    degpntggmgayspvpqisdemmdaaleailrpaakalaaegrpflgvlyaglmatangp
    kviefnarfgdpeaqvvlprlktdlveavlavmdgkelelewtdeavlgvvlaakgypga
    yergaeirgldrispdallfhagtkreggawytnggrvlllaakgetlakakekayeqla
    aidcdglfyrrdigrraierasaaytrmkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yrwA (A:)
    hmnvlvigrggrehaiawkaaqsplvgklyvapgnpgiadvaelvhideldiealvqfak
    qqaidltivgpeaplasgivdrfmaeglrifgpsqraaliegskafakelmkkygiptad
    haaftsyeeakayieqkgapivikadgvtvaqtveealaaakaalvdgqfgtagsqvvie
    eylegeefsfmafvngekvyplaiaqdhkraydgdegpntggmgayspvpqisdemmdaa
    leailrpaakalaaegrpflgvlyaglmatangpkviefnarfgdpeaqvvlprlktdlv
    eavlavmdgkelelewtdeavlgvvlaakgypgayergaeirgldrispdallfhagtkr
    eggawytnggrvlllaakgetlakakekayeqlaaidcdglfyrrdigrraie