PDB entry 2yqx

View 2yqx on RCSB PDB site
Description: Crystal structure of human Cu-Zn Superoxide Dismutase mutant G93A
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, HUMAN CU, ZN SUPEROXIDE DISMUTASE, ALS, FALS, METAL-BINDING, DISEASE MUTATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-31, released 2008-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxa_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxc_
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxd_
  • Chain 'E':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxe_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxf_
  • Chain 'G':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxg_
  • Chain 'H':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxh_
  • Chain 'I':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxi_
  • Chain 'J':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (Start-158)
      • engineered (98)
    Domains in SCOPe 2.06: d2yqxj_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yqxA (A:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxA (A:)
    tkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
    phfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvhe
    kaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yqxB (B:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxB (B:)
    tkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
    phfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvhe
    kaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yqxC (C:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yqxD (D:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxD (D:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yqxE (E:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxE (E:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yqxF (F:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxF (F:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2yqxG (G:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxG (G:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yqxH (H:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxH (H:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2yqxI (I:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxI (I:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2yqxJ (J:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqxJ (J:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdavadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq