PDB entry 2yqv

View 2yqv on RCSB PDB site
Description: Crystal structure of human Cu-Zn Superoxide Dismutase mutant G85R (P21)
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, HUMAN CU, ZN SUPEROXIDE DISMUTASE, ALS, FALS, METAL-BINDING, DISEASE MUTATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-31, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441
      • engineered (90)
    Domains in SCOPe 2.07: d2yqva_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441
      • engineered (90)
    Domains in SCOPe 2.07: d2yqvb_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yqvA (A:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqvA (A:)
    tkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
    phfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvhe
    kaddlgkggneestktgnagsrlacgvigia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yqvB (B:)
    gplgsmatkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdnt
    agctsagphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciig
    rtlvvhekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yqvB (B:)
    atkavcvlkgdgpvqgiinfeqngpvkvwgsikglteglhgfhvhefgdnctsagphfnp
    lsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddl
    gkggneestktgnagsrlacgvigia