PDB entry 2yqd

View 2yqd on RCSB PDB site
Description: Solution structure of the fifth bromodomain from mouse polybromo-1
Class: gene regulation
Keywords: bromodomain, four helices, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polybromo-1
    Species: Mus musculus [TaxId:10090]
    Gene: Pb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BSQ9 (7-119)
      • expression tag (0-6)
      • engineered (52)
    Domains in SCOPe 2.06: d2yqda1, d2yqda2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yqdA (A:)
    gssgssgkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikk
    pmdmekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd