PDB entry 2yoy

View 2yoy on RCSB PDB site
Description: Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate
Class: oxidoreductase
Keywords: oxidoreductase, cellulose oxidation, gh61, cellulose degradation
Deposited on 2012-10-29, released 2013-04-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21085
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rbam17540
  Species: Bacillus amyloliquefaciens [TaxId:1390]
  Database cross-references and differences (RAF-indexed):
  • Uniprot E1UUV3 (0-177)
  Domains in SCOPe 2.02: d2yoya_
• Chain 'B':
  Compound: rbam17540
  Species: Bacillus amyloliquefaciens [TaxId:1390]
  Database cross-references and differences (RAF-indexed):
  • Uniprot E1UUV3 (0-177)
• Heterogens: CU1, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2yoyA (A:)
  hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
  ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
  defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt
  

  
  
• Chain 'B':
  No sequence available.