PDB entry 2ymx

View 2ymx on RCSB PDB site
Description: Crystal structure of inhibitory anti-AChE Fab408
Class: immune system
Keywords: immune system, acetylcholinesterase, inhibition, back door region
Deposited on 2012-10-10, released 2013-10-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.20937
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YMX (0-223)
  • Chain 'L':
    Compound: fab antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2YMX (0-End)
    Domains in SCOPe 2.06: d2ymxl1, d2ymxl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ymxL (L:)
    diqmtqspaslsasvgatvtitcrtsenidsylawyqqrqgkspqllvyaatnladgvps
    rfsgsgsgtqyslkinslqsedvaryycqhysttpwtfgggtqleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ymxL (L:)
    diqmtqspaslsasvgatvtitcrtsenidsylawyqqrqgkspqllvyaatnladgvps
    rfsgsgsgtqyslkinslqsedvaryycqhysttpwtfgggtqleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne