PDB entry 2yki

View 2yki on RCSB PDB site
Description: tricyclic series of hsp90 inhibitors
Class: chaperone
Keywords: chaperone, inhibition
Deposited on 2011-05-27, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.239
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (3-208)
      • expression tag (2)
    Domains in SCOPe 2.07: d2ykia1, d2ykia2
  • Heterogens: YKI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ykiA (A:)
    ghmetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgk
    elhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqf
    gvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedq
    teyleerrikeivkkhsqfigypitlfve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ykiA (A:)
    metfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve