PDB entry 2ykb

View 2ykb on RCSB PDB site
Description: tricyclic series of hsp90 inhibitors
Class: chaperone
Keywords: chaperone, inhibition
Deposited on 2011-05-26, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.2015
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (3-208)
      • expression tag (2)
    Domains in SCOPe 2.07: d2ykba1, d2ykba2
  • Heterogens: YKB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ykbA (A:)
    ghmetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgk
    elhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqf
    gvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedq
    teyleerrikeivkkhsqfigypitlfve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ykbA (A:)
    metfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfve