PDB entry 2yjk

View 2yjk on RCSB PDB site
Description: structure of dps from microbacterium arborescens in the high iron form
Class: metal-binding protein
Keywords: metal-binding protein, iron uptake, ferritin fold
Deposited on 2011-05-19, released 2011-06-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17227
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjka_
  • Chain 'B':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkb_
  • Chain 'C':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkc_
  • Chain 'D':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkd_
  • Chain 'E':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjke_
  • Chain 'F':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkf_
  • Chain 'G':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkg_
  • Chain 'H':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkh_
  • Chain 'I':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjki_
  • Chain 'J':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkj_
  • Chain 'K':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkk_
  • Chain 'L':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjkl_
  • Heterogens: OFE, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yjkA (A:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkA (A:)
    adpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadta
    aerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidglde
    vdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yjkB (B:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkB (B:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yjkC (C:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkC (C:)
    nittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvah
    aqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlq
    aaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yjkD (D:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkD (D:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yjkE (E:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkE (E:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yjkF (F:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkF (F:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2yjkG (G:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkG (G:)
    paltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdy
    adtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaid
    gldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yjkH (H:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkH (H:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2yjkI (I:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkI (I:)
    dpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadtaa
    erivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgldev
    dltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2yjkJ (J:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkJ (J:)
    dpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadtaa
    erivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgldev
    dltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2yjkK (K:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkK (K:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2yjkL (L:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjkL (L:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahlae