PDB entry 2yjj

View 2yjj on RCSB PDB site
Description: structure of dps from microbacterium arborescens in the low iron form
Class: metal-binding protein
Keywords: metal-binding protein, iron uptake, ferritin fold
Deposited on 2011-05-19, released 2011-06-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.17382
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjja_
  • Chain 'B':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjb_
  • Chain 'C':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjc_
  • Chain 'D':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjd_
  • Chain 'E':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjje_
  • Chain 'F':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjf_
  • Chain 'G':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjg_
  • Chain 'H':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjh_
  • Chain 'I':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjji_
  • Chain 'J':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjj_
  • Chain 'K':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjk_
  • Chain 'L':
    Compound: afp
    Species: MICROBACTERIUM ARBORESCENS [TaxId:33883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2yjjl_
  • Heterogens: FE, OFE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yjjA (A:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjA (A:)
    adpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadta
    aerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidglde
    vdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2yjjB (B:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjB (B:)
    altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
    dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
    ldevdltsqdvaieikrgvdkdrwfllahla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yjjC (C:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjC (C:)
    adpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadta
    aerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidglde
    vdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yjjD (D:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjD (D:)
    dpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadtaa
    erivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgldev
    dltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2yjjE (E:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjE (E:)
    tadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadt
    aaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgld
    evdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2yjjF (F:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjF (F:)
    tadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadt
    aaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgld
    evdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2yjjG (G:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjG (G:)
    nittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvah
    aqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlq
    aaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2yjjH (H:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjH (H:)
    pevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadtaae
    rivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgldevd
    ltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2yjjI (I:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjI (I:)
    dpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadtaa
    erivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgldev
    dltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2yjjJ (J:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjJ (J:)
    dpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadtaa
    erivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgldev
    dltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2yjjK (K:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjK (K:)
    adpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadta
    aerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidglde
    vdltsqdvaieikrgvdkdrwfllahlae
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2yjjL (L:)
    mtdtnittpaltadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihellds
    vvahaqdyadtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaal
    vdlqaaidgldevdltsqdvaieikrgvdkdrwfllahlae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yjjL (L:)
    tadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadt
    aaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgld
    evdltsqdvaieikrgvdkdrwfllahlae