PDB entry 2yin

View 2yin on RCSB PDB site
Description: structure of the complex between dock2 and rac1.
Class: apoptosis
Keywords: apoptosis, dock, dock guanine nucleotide exchange factors, rho gtpase
Deposited on 2011-05-16, released 2011-05-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2059
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dedicator of cytokinesis protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: dedicator of cytokinesis protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (19-195)
      • expression tag (16-18)
    Domains in SCOPe 2.03: d2yinc_
  • Chain 'D':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (19-195)
      • expression tag (15-18)
    Domains in SCOPe 2.03: d2yind_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2yinC (C:)
    mahhhhhhssglevlfqgtmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnys
    anvmvdgkpvnlglwdtagqedydrlrplsypqtdvflicfslvspasfenvrakwypev
    rhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsalt
    qrglktvfdeairavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yinC (C:)
    qgtmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwd
    tagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkl
    dlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2yinD (D:)
    mahhhhhhssglevlfqgtmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnys
    anvmvdgkpvnlglwdtagqedydrlrplsypqtdvflicfslvspasfenvrakwypev
    rhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsalt
    qrglktvfdeairavl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yinD (D:)
    fqgtmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglw
    dtagqedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtk
    ldlrddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairav
    l