PDB entry 2ydn

View 2ydn on RCSB PDB site
Description: Plasmodium falciparum L-Lactate Dehydrogenase complexed with bicine
Class: oxidoreductase
Keywords: oxidoreductase, antimalarials, enzyme inhibitors
Deposited on 2011-03-22, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.165
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.06: d2ydna1, d2ydna2, d2ydna3
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.06: d2ydnb1, d2ydnb2, d2ydnb3
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316)
    Domains in SCOPe 2.06: d2ydnc1, d2ydnc2, d2ydnc3
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q71T02 (Start-315)
      • expression tag (316-317)
    Domains in SCOPe 2.06: d2ydnd1, d2ydnd2, d2ydnd3
  • Heterogens: BCN, CA, MPD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ydnA (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydnA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkalah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ydnB (B:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydnB (B:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
    vqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkry
    itvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesylk
    dlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkrm
    kalah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ydnC (C:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydnC (C:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
    vqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkry
    itvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesylk
    dlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkrm
    kalah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ydnD (D:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkalahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydnD (D:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftrddllplnnkimieigghikkncpnafiivvtnpvdvm
    vqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkry
    itvggiplqefinnklisdaeleaifdrtvntaleivnlhaspyvapaaaiiemaesylk
    dlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekakfdeaiaetkrm
    kalahh