PDB entry 2yde

View 2yde on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with s-2-hydroxyglutarate
Class: oxidoreductase
Keywords: oxidoreductase, non-heme iron, dioxygenase, metal-binding, transcription, helix-loop-helix-beta, dsbh, facial triad, asparaginyl/ aspartyl hydroxylase, ankyrin repeat domain, ard, beta-hydroxylation, transcription activator/inhibitor
Deposited on 2011-03-18, released 2011-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ydea_
  • Heterogens: FE, S2G, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ydeA (A:)
    gshmaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelie
    neepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkpr
    snreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkr
    gwgqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcd
    rqsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwy
    kgaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ydeA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn