PDB entry 2yat

View 2yat on RCSB PDB site
Description: Crystal structure of estradiol derived metal chelate and estrogen receptor-ligand binding domain complex
Class: transcription
Keywords: transcription
Deposited on 2011-02-24, released 2011-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-16, with a file datestamp of 2012-05-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.1842
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (1-End)
      • engineered mutation (81)
      • engineered mutation (230)
    Domains in SCOPe 2.06: d2yata_
  • Heterogens: EU, EEU, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yatA (A:)
    mskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhmin
    wakrvpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksve
    gmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvl
    dkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydl
    llemldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yatA (A:)
    skknslalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdl
    tlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrneifdmllatssrfrmmn
    lqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltlqqqh
    qrlaqlllilshirhmsnkgmehlysmksknvvplydlllemldahr