PDB entry 2ya3

View 2ya3 on RCSB PDB site
Description: structure of the regulatory fragment of mammalian ampk in complex with coumarin ADP
Class: transferase
Keywords: transferase, nucleotide-binding, serine/threonine-protein kinase, phosphorylation
Deposited on 2011-02-17, released 2011-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22463
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-amp-activated protein kinase catalytic subunit alpha-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54645 (18-166)
      • cloning artifact (16-17)
      • cloning artifact (167-171)
    Domains in SCOPe 2.07: d2ya3a1, d2ya3a2, d2ya3a3
  • Chain 'B':
    Compound: 5'-amp-activated protein kinase subunit beta-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ya3b_
  • Chain 'E':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ya3e1, d2ya3e2
  • Heterogens: J7V, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ya3A (A:)
    mshhhhhhsglvprgsmawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrk
    npvtstfskmslqlyqvdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsds
    daeaqgkpsevsltssvtsldsspvdvaprpgshtieffemcanliknsctvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ya3A (A:)
    mawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyq
    vdsrtylldfrsiddevaprpgshtieffemcanliknsctv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ya3B (B:)
    mgpygqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyals
    ikdsvmvlsathrykkkyvttllykpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ya3B (B:)
    gqemyafrseerfksppilpphllqvilnkhvmlnhlyalsikdsvmvlsathrykkkyv
    ttllykpi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ya3E (E:)
    mesvaaesapapenehsqetpesnssvyttfmkshrcydliptssklvvfdtslqvkkaf
    falvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkietwrevy
    lqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkflklfit
    efpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiy
    skfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlv
    vvdehdvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ya3E (E:)
    ssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvgm
    ltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavssl
    irnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyania
    mvrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtka
    lqhrshyfegvlkcylhetleaiinrlveaevhrlvvvdehdvvkgivslsdilqalvlt