PDB entry 2y8e

View 2y8e on RCSB PDB site
Description: crystal structure of d. melanogaster rab6 gtpase bound to gmppnp
Class: hydrolase
Keywords: hydrolase, nucleotide binding, GTP binding
Deposited on 2011-02-04, released 2011-07-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.14607
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rab-protein 6
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y8ea_
  • Chain 'B':
    Compound: rab-protein 6
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2y8eb_
  • Heterogens: SO4, GNP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y8eA (A:)
    gtmssgdfgnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyled
    rtvrlqlwdtagqerfrslipsyirdstvavvvyditntnsfhqtskwiddvrtergsdv
    iimlvgnktdlsdkrqvsteegerkakelnvmfietsakagynvkqlfrrvaaalpgmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y8eA (A:)
    lrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlwdta
    gqerfrslipsyirdstvavvvyditntnsfhqtskwiddvrtergsdviimlvgnktdl
    sdkrqvsteegerkakelnvmfietsakagynvkqlfrrvaaalp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2y8eB (B:)
    gtmssgdfgnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyled
    rtvrlqlwdtagqerfrslipsyirdstvavvvyditntnsfhqtskwiddvrtergsdv
    iimlvgnktdlsdkrqvsteegerkakelnvmfietsakagynvkqlfrrvaaalpgmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y8eB (B:)
    gnplrkfklvflgeqsvgktslitrfmydsfdntyqatigidflsktmyledrtvrlqlw
    dtagqerfrslipsyirdstvavvvyditntnsfhqtskwiddvrtergsdviimlvgnk
    tdlsdkrqvsteegerkakelnvmfietsakagynvkqlfrrvaaal