PDB entry 2y84

View 2y84 on RCSB PDB site
Description: dntr inducer binding domain
Class: transcription
Keywords: transcription
Deposited on 2011-02-03, released 2011-07-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2191
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50
• Chain 'B':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50 (Start-221)
• Chain 'C':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50 (Start-221)
• Chain 'D':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50
• Chain 'E':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50
• Chain 'F':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50 (Start-221)
• Chain 'G':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50 (Start-221)
• Chain 'H':
  Compound: LysR-type regulatory protein
  Species: BURKHOLDERIA SP. DNT [TaxId:233098]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7WT50
  Domains in SCOPe 2.02: d2y84h_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  Sequence, based on SEQRES records: (download)
  

  >2y84H (H:)
  mqtalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlk
  edmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgv
  valntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfgl
  ttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfseahhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2y84H (H:)
  fdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavdl
  algllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqftelehvgvvalntghgev
  dglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpaklp
  diainlfwhakynrdpgnmwlrqlfvelfse