PDB entry 2y1a

View 2y1a on RCSB PDB site
Description: crystal structure of achromobacter cycloclastes cu nitrite reductase with bound no
Class: oxidoreductase
Keywords: oxidoreductase, denitrification
Deposited on 2010-12-07, released 2011-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.15635
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y1aa1, d2y1aa2
  • Heterogens: CU, NO, ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y1aA (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y1aA (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvvkpas