PDB entry 2y0i

View 2y0i on RCSB PDB site
Description: factor inhibiting hif-1 alpha in complex with tankyrase-2 (tnks2) fragment peptide (21-mer)
Class: oxidoreductase/peptide
Keywords: oxidoreductase-peptide complex, dioxygenase, helix-loop-helix-beta, facial triad, asparaginyl/aspartyl hydroxylase, ankyrin repeat domain
Deposited on 2010-12-02, released 2011-02-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.2296
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2y0ia_
  • Chain 'S':
    Compound: tankyrase-2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE2, AKG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2y0iA (A:)
    gshmaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelie
    neepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkpr
    snreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkr
    gwgqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcd
    rqsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwy
    kgaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2y0iA (A:)
    sgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlv
    ypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefve
    klqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlllig
    megnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdye
    rfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieypl
    kahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'S':
    No sequence available.