PDB entry 2xzh

View 2xzh on RCSB PDB site
Description: Clathrin Terminal Domain Complexed with Pitstop 2
Class: endocytosis
Keywords: endocytosis, endocytosis inhibition
Deposited on 2010-11-25, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.17314
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clathrin heavy chain 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00610 (1-End)
      • expression tag (0)
      • conflict (357)
    Domains in SCOPe 2.07: d2xzha1, d2xzha2, d2xzha3
  • Heterogens: VH2, DMS, ACT, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xzhA (A:)
    fmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndps
    npirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntv
    alvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvg
    amqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptg
    nqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnris
    getifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnnag
    aeelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzhA (A:)
    fmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndps
    npirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntv
    alvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvg
    amqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptg
    nqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnris
    getifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnn