PDB entry 2xzg

View 2xzg on RCSB PDB site
Description: clathrin terminal domain complexed with pitstop 1
Class: endocytosis
Keywords: endocytosis, endocytosis inhibition
Deposited on 2010-11-25, released 2011-08-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16071
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clathrin heavy chain 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00610 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d2xzga1, d2xzga2
  • Heterogens: PEG, GOL, ACT, VH1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xzgA (A:)
    fmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndps
    npirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntv
    alvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvg
    amqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptg
    nqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnris
    getifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlag
    aeelf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xzgA (A:)
    fmaqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndps
    npirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntv
    alvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvg
    amqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptg
    nqpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnris
    getifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnl